SCOPe 2.08: Domain d1jshb_: 1jsh B:

Lineage for d1jshb_ (1jsh B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)

8. Domain d1jshb_: 1jsh B: [63261]
   Other proteins in same PDB: d1jsha_
   complexed with nag

Details for d1jshb_

PDB Entry: 1jsh, 2.4 Å

PDB Description: crystal structure of h9 haemagglutinin complexed with lsta receptor analog

PDB Compounds: (B:) haemagglutinin (ha2 chain)

SCOPe Domain Sequences for d1jshb_:

Sequence; same for both SEQRES and ATOM records:

>d1jshb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwpglvagwygfqhsndqgvgmaadsdstqkaidkitskvnnivdkmn
kqygiidhefseietrlnminnkiddqiqdiwtynaellvllenqktldehdanvnnlyn
kvkralgsnamedgkgcfelyhkcddqcmetirngtynrr

Timeline for d1jshb_:

• d1jshb_ first appeared in SCOP 1.57
  
• d1jshb_ appears in SCOPe 2.07