Lineage for d1jsda_ (1jsd A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226172Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 226173Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 226203Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 226204Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 226205Species Influenza A virus, different strains [TaxId:11320] [49825] (25 PDB entries)
  8. 226206Domain d1jsda_: 1jsd A: [63258]
    Other proteins in same PDB: d1jsdb_
    complexed with nag, po4

Details for d1jsda_

PDB Entry: 1jsd (more details), 1.8 Å

PDB Description: crystal structure of swine h9 haemagglutinin

SCOP Domain Sequences for d1jsda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsda_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
dkicigyqstnstetvdtltetnvpvthakellhtshngmlcatnlghplildtctiegl
iygnpscdlllggrewsyiverpsavngmcypgnvenleelrslfssassyqriqifpdt
iwnvsysgtssacsdsfyrsmrwltqknnaypiqdaqytnnrgksilfmwginhpptdtv
qtnlytrtdtttsvttedinrtfkpvigprplvnglhgridyywsvlkpgqtlrvrsngn
liapwyghilsgeshgrilktdlnsgncvvqcqtergglnttlpfhnvskyafgncpkyv
gvkslklavglrnvpar

SCOP Domain Coordinates for d1jsda_:

Click to download the PDB-style file with coordinates for d1jsda_.
(The format of our PDB-style files is described here.)

Timeline for d1jsda_: