Lineage for d1jqta_ (1jqt A:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146112Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 146113Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 146114Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 146115Protein 70S ribosome functional complex [58121] (2 species)
  7. Species Escherichia coli [TaxId:562] [58123] (5 PDB entries)
  8. 146137Domain d1jqta_: 1jqt A: [63240]

Details for d1jqta_

PDB Entry: 1jqt (more details)

PDB Description: Fitting of L11 protein in the low resolution cryo-EM map of E.coli 70S ribosome

SCOP Domain Sequences for d1jqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqta_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOP Domain Coordinates for d1jqta_:

Click to download the PDB-style file with coordinates for d1jqta_.
(The format of our PDB-style files is described here.)

Timeline for d1jqta_: