SCOPe 2.07: Domain d1jqsc_: 1jqs C:

Lineage for d1jqsc_ (1jqs C:)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1jqsc_: 1jqs C: [63239]
   Fitting of L11 and EF-G domains G' and V in the cryo-EM map

Details for d1jqsc_

PDB Entry: 1jqs

PDB Description: Fitting of L11 protein and elongation factor G (domain G' and V) in the cryo-em map of E. coli 70S ribosome bound with EF-G and GMPPCP, a nonhydrolysable GTP analog

PDB Compounds: (C:) Elongation factor G

SCOPe Domain Sequences for d1jqsc_:

Sequence; same for both SEQRES and ATOM records:

>d1jqsc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqg
rgsfvmff

Timeline for d1jqsc_:

• d1jqsc_ first appeared in SCOP 1.57
  
• d1jqsc_ appears in SCOPe 2.06
  
• d1jqsc_ appears in the current release, SCOPe 2.08