Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1jqsc_: 1jqs C: [63239] Fitting of L11 and EF-G domains G' and V in the cryo-EM map |
PDB Entry: 1jqs (more details)
SCOPe Domain Sequences for d1jqsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jqsc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqg rgsfvmff
Timeline for d1jqsc_: