SCOP 1.65: Domain d1jqcb_: 1jqc B:

Lineage for d1jqcb_ (1jqc B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)
   contains dimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (6 species)

7. Species Escherichia coli [TaxId:562] [47258] (13 PDB entries)

8. Domain d1jqcb_: 1jqc B: [63230]
   complexed with hg, mn

Details for d1jqcb_

PDB Entry: 1jqc, 1.61 Å

PDB Description: Mn substituted Ribonucleotide reductase R2 from E. Coli oxidized by hydrogen peroxide and hydroxylamine

SCOP Domain Sequences for d1jqcb_:

Sequence; same for both SEQRES and ATOM records:

>d1jqcb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

Timeline for d1jqcb_:

• d1jqcb_ first appeared in SCOP 1.57
  
• d1jqcb_ appears in SCOP 1.63
  
• d1jqcb_ appears in SCOP 1.67
  
• d1jqcb_ appears in the current release, SCOPe 2.08