Lineage for d1jpra_ (1jpr A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46831Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 46907Protein Ribonucleotide reductase R2 [47257] (4 species)
  7. 46911Species Escherichia coli [TaxId:562] [47258] (10 PDB entries)
  8. 46914Domain d1jpra_: 1jpr A: [63224]

Details for d1jpra_

PDB Entry: 1jpr (more details), 1.88 Å

PDB Description: Mn substituted Ribonucleotide reductase R2 from E. coli oxidized by nitric oxide

SCOP Domain Sequences for d1jpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

SCOP Domain Coordinates for d1jpra_:

Click to download the PDB-style file with coordinates for d1jpra_.
(The format of our PDB-style files is described here.)

Timeline for d1jpra_: