Lineage for d1jou.2 (1jou C:,D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319090Protein Thrombin [50531] (2 species)
  7. 1319126Species Human (Homo sapiens) [TaxId:9606] [50532] (168 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 1319164Domain d1jou.2: 1jou C:,D: [63219]
    complexed with acy, gol, na, ndg

Details for d1jou.2

PDB Entry: 1jou (more details), 1.8 Å

PDB Description: crystal structure of native s195a thrombin with an unoccupied active site
PDB Compounds: (C:) Thrombin, light chain, (D:) Thrombin, heavy chain

SCOPe Domain Sequences for d1jou.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jou.2 b.47.1.2 (C:,D:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tseyqtffnprtfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigms
pwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtrye
rniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqa
gykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykp
degkrgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqk
vidqf

SCOPe Domain Coordinates for d1jou.2:

Click to download the PDB-style file with coordinates for d1jou.2.
(The format of our PDB-style files is described here.)

Timeline for d1jou.2: