Lineage for d1jn3a_ (1jn3 A:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200829Family e.9.1.1: DNA polymerase beta-like [56700] (3 proteins)
  6. 200830Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 200922Species Rat (Rattus norvegicus) [TaxId:10116] [56703] (17 PDB entries)
  8. 200923Domain d1jn3a_: 1jn3 A: [63183]

Details for d1jn3a_

PDB Entry: 1jn3 (more details), 2.35 Å

PDB Description: fidelity properties and structure of m282l mutator mutant of dna polymerase: subtle structural changes influence the mechanism of nucleotide discrimination

SCOP Domain Sequences for d1jn3a_:

Sequence, based on SEQRES records: (download)

>d1jn3a_ e.9.1.1 (A:) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
lhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycgvl
yftgsdifnknlrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrep
kdrse

Sequence, based on observed residues (ATOM records): (download)

>d1jn3a_ e.9.1.1 (A:) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
lhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvlyft
gsdifnknlrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdr
se

SCOP Domain Coordinates for d1jn3a_:

Click to download the PDB-style file with coordinates for d1jn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1jn3a_: