Class g: Small proteins [56992] (79 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (2 families) |
Family g.24.1.1: TNF receptor-like [57587] (4 proteins) Pfam 00020; TNFR/NGFR cysteine-rich region |
Protein Cellular receptor HveA [64568] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64569] (1 PDB entry) |
Domain d1jmab2: 1jma B:60-105 [63179] Other proteins in same PDB: d1jmaa_ complexed with nag, so4; mutant |
PDB Entry: 1jma (more details), 2.65 Å
SCOP Domain Sequences for d1jmab2:
Sequence, based on SEQRES records: (download)
>d1jmab2 g.24.1.1 (B:60-105) Cellular receptor HveA {Human (Homo sapiens)} mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayat
>d1jmab2 g.24.1.1 (B:60-105) Cellular receptor HveA {Human (Homo sapiens)} mcdpamglrasrncsrtenavcgcspghfcivqdhcaacrayat
Timeline for d1jmab2: