Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Tyrosine phosphatase [52806] (7 species) |
Species Mouse (Mus musculus), ptp-sl/br7 [TaxId:10090] [64051] (1 PDB entry) |
Domain d1jlna1: 1jln A:254-548 [63172] Other proteins in same PDB: d1jlna2 |
PDB Entry: 1jln (more details), 1.81 Å
SCOPe Domain Sequences for d1jlna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlna1 c.45.1.2 (A:254-548) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} prekvameylqsasrvltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtknry ktilpnplsrvclrpknitdslstyinanyirgysgkekafiatqgpmintvndfwqmvw qedspvivmitklkeknekcvlywpekrgiygkvevlvtgvtecdnytirnlvlkqgsht qhvkhywytswpdhktpdsaqpllqlmldveedrlasegrgpvvvhcsagigrtgcfiat sigcqqlkeegvvdalsivcqlrvdrggmvqtseqyefvhhalclfesrlspetv
Timeline for d1jlna1: