SCOPe 2.06: Domain d1jlna1: 1jln A:254-548

Lineage for d1jlna1 (1jln A:254-548)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Mouse (Mus musculus), ptp-sl/br7 [TaxId:10090] [64051] (1 PDB entry)

8. Domain d1jlna1: 1jln A:254-548 [63172]
   Other proteins in same PDB: d1jlna2

Details for d1jlna1

PDB Entry: 1jln, 1.81 Å

PDB Description: Crystal structure of the catalytic domain of protein tyrosine phosphatase PTP-SL/BR7

PDB Compounds: (A:) Protein Tyrosine Phosphatase, receptor type, R

SCOPe Domain Sequences for d1jlna1:

Sequence; same for both SEQRES and ATOM records:

>d1jlna1 c.45.1.2 (A:254-548) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]}
prekvameylqsasrvltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtknry
ktilpnplsrvclrpknitdslstyinanyirgysgkekafiatqgpmintvndfwqmvw
qedspvivmitklkeknekcvlywpekrgiygkvevlvtgvtecdnytirnlvlkqgsht
qhvkhywytswpdhktpdsaqpllqlmldveedrlasegrgpvvvhcsagigrtgcfiat
sigcqqlkeegvvdalsivcqlrvdrggmvqtseqyefvhhalclfesrlspetv

Timeline for d1jlna1:

• d1jlna1 first appeared in SCOP 1.57, called d1jlna_
  
• d1jlna1 was called d1jlna_ in SCOPe 2.05
  
• d1jlna1 appears in SCOPe 2.07
  
• d1jlna1 appears in the current release, SCOPe 2.08