![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.1: MogA-like [53219] (6 proteins) |
![]() | Protein Gephyrin N-terminal domain [64100] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64102] (1 PDB entry) the human neuroreceptor anchoring protein |
![]() | Domain d1jlja_: 1jlj A: [63169] complexed with fmt, na |
PDB Entry: 1jlj (more details), 1.6 Å
SCOPe Domain Sequences for d1jlja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlja_ c.57.1.1 (A:) Gephyrin N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd
Timeline for d1jlja_: