Lineage for d1jl8a3 (1jl8 A:121-502)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339620Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 1339635Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (16 PDB entries)
  8. 1339656Domain d1jl8a3: 1jl8 A:121-502 [63165]
    Other proteins in same PDB: d1jl8a1, d1jl8a2, d1jl8b1, d1jl8b2
    complexed with bcd

Details for d1jl8a3

PDB Entry: 1jl8 (more details), 3.2 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with beta-cyclodextrin based on a co-crystallization with methyl beta-cyclodextrin
PDB Compounds: (A:) alpha-amylase II

SCOPe Domain Sequences for d1jl8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl8a3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOPe Domain Coordinates for d1jl8a3:

Click to download the PDB-style file with coordinates for d1jl8a3.
(The format of our PDB-style files is described here.)

Timeline for d1jl8a3: