SCOP 1.71: Domain d1jl4d2: 1jl4 D:98-178

Lineage for d1jl4d2 (1jl4 D:98-178)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries)

8. Domain d1jl4d2: 1jl4 D:98-178 [63162]
   Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d1
   domain 2

Details for d1jl4d2

PDB Entry: 1jl4, 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

SCOP Domain Sequences for d1jl4d2:

Sequence; same for both SEQRES and ATOM records:

>d1jl4d2 b.1.1.3 (D:98-178) CD4 C2-set domains {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d1jl4d2:

• d1jl4d2 first appeared in SCOP 1.57
  
• d1jl4d2 appears in SCOP 1.69
  
• d1jl4d2 appears in SCOP 1.73
  
• d1jl4d2 appears in the current release, SCOPe 2.08