Lineage for d1jl4d2 (1jl4 D:98-178)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290164Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 290174Protein CD4 [49149] (2 species)
  7. 290175Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries)
  8. 290185Domain d1jl4d2: 1jl4 D:98-178 [63162]
    Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d1

Details for d1jl4d2

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

SCOP Domain Sequences for d1jl4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4d2 b.1.1.3 (D:98-178) CD4 {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1jl4d2:

Click to download the PDB-style file with coordinates for d1jl4d2.
(The format of our PDB-style files is described here.)

Timeline for d1jl4d2: