SCOP 1.73: Domain d1jl4b2: 1jl4 B:5-92

Lineage for d1jl4b2 (1jl4 B:5-92)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Mouse (Mus musculus), I-AK [TaxId:10090] [88826] (3 PDB entries)

8. Domain d1jl4b2: 1jl4 B:5-92 [63160]
   Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4d1, d1jl4d2

Details for d1jl4b2

PDB Entry: 1jl4, 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

PDB Compounds: (B:) h-2 class II histocompatibility antigen, a-k beta chain

SCOP Domain Sequences for d1jl4b2:

Sequence; same for both SEQRES and ATOM records:

>d1jl4b2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
ylertraeldtvcrhnyektetptslr

Timeline for d1jl4b2:

• d1jl4b2 first appeared in SCOP 1.57
  
• d1jl4b2 appears in SCOP 1.71
  
• d1jl4b2 appears in SCOP 1.75
  
• d1jl4b2 appears in the current release, SCOPe 2.08