Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species) |
Species Mouse (Mus musculus), I-AK [TaxId:10090] [54464] (3 PDB entries) |
Domain d1jl4a2: 1jl4 A:5-81 [63158] Other proteins in same PDB: d1jl4a1, d1jl4b1, d1jl4d1, d1jl4d2 |
PDB Entry: 1jl4 (more details), 4.3 Å
SCOP Domain Sequences for d1jl4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl4a2 d.19.1.1 (A:5-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK} hvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgglqni atgkhnleiltkrsnstp
Timeline for d1jl4a2:
View in 3D Domains from other chains: (mouse over for more information) d1jl4b1, d1jl4b2, d1jl4d1, d1jl4d2 |