Lineage for d1jl4a1 (1jl4 A:82-181)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364807Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 364852Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 364865Domain d1jl4a1: 1jl4 A:82-181 [63157]
    Other proteins in same PDB: d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d1, d1jl4d2

Details for d1jl4a1

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

SCOP Domain Sequences for d1jl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4a1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOP Domain Coordinates for d1jl4a1:

Click to download the PDB-style file with coordinates for d1jl4a1.
(The format of our PDB-style files is described here.)

Timeline for d1jl4a1: