![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d1jl4a1: 1jl4 A:82-181 [63157] Other proteins in same PDB: d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d1, d1jl4d2 |
PDB Entry: 1jl4 (more details), 4.3 Å
SCOP Domain Sequences for d1jl4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl4a1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group} atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr dysfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d1jl4a1:
![]() Domains from other chains: (mouse over for more information) d1jl4b1, d1jl4b2, d1jl4d1, d1jl4d2 |