Lineage for d1jk9d1 (1jk9 D:74-245)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55083Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 55084Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 55085Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)
  7. 55086Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49342] (3 PDB entries)
  8. 55091Domain d1jk9d1: 1jk9 D:74-245 [63153]
    Other proteins in same PDB: d1jk9a_, d1jk9b2, d1jk9c_, d1jk9d2

Details for d1jk9d1

PDB Entry: 1jk9 (more details), 2.9 Å

PDB Description: Heterodimer between H48F-ySOD1 and yCCS

SCOP Domain Sequences for d1jk9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk9d1 b.1.8.1 (D:74-245) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi
hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis
kslnhpenepssvkdysflgviarsagvwennkqvcactgktvweerkdala

SCOP Domain Coordinates for d1jk9d1:

Click to download the PDB-style file with coordinates for d1jk9d1.
(The format of our PDB-style files is described here.)

Timeline for d1jk9d1: