Lineage for d1jk9c_ (1jk9 C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55083Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 55084Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 55097Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 55104Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (8 PDB entries)
  8. 55116Domain d1jk9c_: 1jk9 C: [63152]
    Other proteins in same PDB: d1jk9b1, d1jk9b2, d1jk9d1, d1jk9d2

Details for d1jk9c_

PDB Entry: 1jk9 (more details), 2.9 Å

PDB Description: heterodimer between h48f-ysod1 and yccs

SCOP Domain Sequences for d1jk9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk9c_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae)}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhifefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

SCOP Domain Coordinates for d1jk9c_:

Click to download the PDB-style file with coordinates for d1jk9c_.
(The format of our PDB-style files is described here.)

Timeline for d1jk9c_: