Lineage for d1jk9b2 (1jk9 B:3-73)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192610Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 192611Family d.58.17.1: Metal-binding domain [55009] (7 proteins)
  6. 192630Protein Copper chaperone for superoxide dismutase, N-terminal domain [55019] (1 species)
  7. 192631Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55020] (2 PDB entries)
  8. 192634Domain d1jk9b2: 1jk9 B:3-73 [63151]
    Other proteins in same PDB: d1jk9a_, d1jk9b1, d1jk9c_, d1jk9d1

Details for d1jk9b2

PDB Entry: 1jk9 (more details), 2.9 Å

PDB Description: heterodimer between h48f-ysod1 and yccs

SCOP Domain Sequences for d1jk9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk9b2 d.58.17.1 (B:3-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
tndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlr
ncgkdaiirga

SCOP Domain Coordinates for d1jk9b2:

Click to download the PDB-style file with coordinates for d1jk9b2.
(The format of our PDB-style files is described here.)

Timeline for d1jk9b2: