SCOP 1.67: Domain d1jk8b2: 1jk8 B:3-94

Lineage for d1jk8b2 (1jk8 B:3-94)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [88825] (1 PDB entry)

8. Domain d1jk8b2: 1jk8 B:3-94 [63148]
   Other proteins in same PDB: d1jk8a1, d1jk8a2, d1jk8b1
   complexed with a human insulin peptide
   complexed with nag

Details for d1jk8b2

PDB Entry: 1jk8, 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex

SCOP Domain Sequences for d1jk8b2:

Sequence; same for both SEQRES and ATOM records:

>d1jk8b2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ8}
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlqrr

Timeline for d1jk8b2:

• d1jk8b2 first appeared in SCOP 1.57
  
• d1jk8b2 appears in SCOP 1.65
  
• d1jk8b2 appears in SCOP 1.69
  
• d1jk8b2 appears in the current release, SCOPe 2.08