Lineage for d1jk8b2 (1jk8 B:3-94)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409679Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 409687Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [88825] (1 PDB entry)
  8. 409688Domain d1jk8b2: 1jk8 B:3-94 [63148]
    Other proteins in same PDB: d1jk8a1, d1jk8a2, d1jk8b1
    complexed with a human insulin peptide
    complexed with nag

Details for d1jk8b2

PDB Entry: 1jk8 (more details), 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex

SCOP Domain Sequences for d1jk8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk8b2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ8}
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlqrr

SCOP Domain Coordinates for d1jk8b2:

Click to download the PDB-style file with coordinates for d1jk8b2.
(The format of our PDB-style files is described here.)

Timeline for d1jk8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jk8b1