SCOP 1.71: Domain d1jk8b1: 1jk8 B:95-192

Lineage for d1jk8b1 (1jk8 B:95-192)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88630] (3 PDB entries)
   probably orthologous to the mouse I-A group

8. Domain d1jk8b1: 1jk8 B:95-192 [63147]
   Other proteins in same PDB: d1jk8a1, d1jk8a2, d1jk8b2
   complexed with a human insulin peptide
   complexed with nag

Details for d1jk8b1

PDB Entry: 1jk8, 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex

SCOP Domain Sequences for d1jk8b1:

Sequence; same for both SEQRES and ATOM records:

>d1jk8b1 b.1.1.2 (B:95-192) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group}
veptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwt
fqilvmlemtpqrgdvytchvehpslqnpiivewraqs

Timeline for d1jk8b1:

• d1jk8b1 first appeared in SCOP 1.57
  
• d1jk8b1 appears in SCOP 1.69
  
• d1jk8b1 appears in SCOP 1.73
  
• d1jk8b1 appears in the current release, SCOPe 2.08