SCOPe 2.01: Domain d1jk8a2: 1jk8 A:2-84

Lineage for d1jk8a2 (1jk8 A:2-84)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [88812] (1 PDB entry)

8. Domain d1jk8a2: 1jk8 A:2-84 [63146]
   Other proteins in same PDB: d1jk8a1, d1jk8b1, d1jk8b2
   complexed with a human insulin peptide
   complexed with nag

Details for d1jk8a2

PDB Entry: 1jk8, 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex

PDB Compounds: (A:) MHC class II HLA-DQ8

SCOPe Domain Sequences for d1jk8a2:

Sequence; same for both SEQRES and ATOM records:

>d1jk8a2 d.19.1.1 (A:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ8 [TaxId: 9606]}
vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal
tniavlkhnlnivikrsnstaatn

Timeline for d1jk8a2:

• d1jk8a2 first appeared in SCOP 1.57
  
• d1jk8a2 appears in SCOP 1.75
  
• d1jk8a2 appears in SCOPe 2.02
  
• d1jk8a2 appears in the current release, SCOPe 2.08