Lineage for d1jk8a2 (1jk8 A:2-84)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719728Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 719736Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [88812] (1 PDB entry)
  8. 719737Domain d1jk8a2: 1jk8 A:2-84 [63146]
    Other proteins in same PDB: d1jk8a1, d1jk8b1, d1jk8b2
    complexed with a human insulin peptide
    complexed with nag

Details for d1jk8a2

PDB Entry: 1jk8 (more details), 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex
PDB Compounds: (A:) MHC class II HLA-DQ8

SCOP Domain Sequences for d1jk8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk8a2 d.19.1.1 (A:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ8 [TaxId: 9606]}
vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal
tniavlkhnlnivikrsnstaatn

SCOP Domain Coordinates for d1jk8a2:

Click to download the PDB-style file with coordinates for d1jk8a2.
(The format of our PDB-style files is described here.)

Timeline for d1jk8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jk8a1