Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [88812] (1 PDB entry) |
Domain d1jk8a2: 1jk8 A:2-84 [63146] Other proteins in same PDB: d1jk8a1, d1jk8b1, d1jk8b2 complexed with a human insulin peptide complexed with nag |
PDB Entry: 1jk8 (more details), 2.4 Å
SCOP Domain Sequences for d1jk8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk8a2 d.19.1.1 (A:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ8} vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal tniavlkhnlnivikrsnstaatn
Timeline for d1jk8a2: