SCOPe 2.02: Domain d1jk8a1: 1jk8 A:85-181

Lineage for d1jk8a1 (1jk8 A:85-181)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88623] (3 PDB entries)
   probably orthologous to the mouse I-A group

8. Domain d1jk8a1: 1jk8 A:85-181 [63145]
   Other proteins in same PDB: d1jk8a2, d1jk8b1, d1jk8b2
   complexed with a human insulin peptide
   complexed with nag

Details for d1jk8a1

PDB Entry: 1jk8, 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex

PDB Compounds: (A:) MHC class II HLA-DQ8

SCOPe Domain Sequences for d1jk8a1:

Sequence; same for both SEQRES and ATOM records:

>d1jk8a1 b.1.1.2 (A:85-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]}
evpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsksdhs
ffkisyltflpsddeiydckvehwgldepllkhwepe

Timeline for d1jk8a1:

• d1jk8a1 first appeared in SCOP 1.57
  
• d1jk8a1 appears in SCOPe 2.01
  
• d1jk8a1 appears in SCOPe 2.03
  
• d1jk8a1 appears in the current release, SCOPe 2.08