Lineage for d1jk0b_ (1jk0 B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96482Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 96483Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 96607Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 96683Protein Ribonucleotide reductase R2 [47257] (5 species)
  7. 96684Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63527] (1 PDB entry)
  8. 96686Domain d1jk0b_: 1jk0 B: [63143]

Details for d1jk0b_

PDB Entry: 1jk0 (more details), 2.8 Å

PDB Description: Ribonucleotide reductase Y2Y4 heterodimer

SCOP Domain Sequences for d1jk0b_:

Sequence, based on SEQRES records: (download)

>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae)}
fqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtaeeielakdted
fqkltddqktyignllalsissdnlvnkylienfsaqlqnpegksfygfqimmeniysev
ysmmvdaffkdpkniplfkeianlpevkhkaafierwisnddslyaerlvafaakegifq
agnyasmfwltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnpkiiekiitea
veiekeyysnslpvekfgmdlksihtyiefvadgllqgfgnekyy

Sequence, based on observed residues (ATOM records): (download)

>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae)}
fqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtaeeielakdted
fqkltddqktyignllalsilienfsaqlqnpegksfygfqimmeniysevysmmvdaff
kdpkniplfkeianlpevkhkaafierwisnddslyaerlvafaakegifqagnyasmfw
ltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnpkiiekiiteaveiekeyys
nslphtyiefvadgllqgfgnekyy

SCOP Domain Coordinates for d1jk0b_:

Click to download the PDB-style file with coordinates for d1jk0b_.
(The format of our PDB-style files is described here.)

Timeline for d1jk0b_: