Lineage for d1jk0a_ (1jk0 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212337Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 212429Protein Ribonucleotide reductase R2 [47257] (5 species)
  7. 212430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63527] (1 PDB entry)
  8. 212431Domain d1jk0a_: 1jk0 A: [63142]

Details for d1jk0a_

PDB Entry: 1jk0 (more details), 2.8 Å

PDB Description: Ribonucleotide reductase Y2Y4 heterodimer

SCOP Domain Sequences for d1jk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae)}
lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasd
givnenlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaih
tipeigekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfs
nelicrdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnad
lmnqyvefvadrllvafgnkkyykvenpfdfmen

SCOP Domain Coordinates for d1jk0a_:

Click to download the PDB-style file with coordinates for d1jk0a_.
(The format of our PDB-style files is described here.)

Timeline for d1jk0a_: