Lineage for d1jk0a_ (1jk0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703463Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2703464Species Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId:4932] [88795] (2 PDB entries)
    Uniprot P09938
  8. 2703465Domain d1jk0a_: 1jk0 A: [63142]
    heterodimer with Y4 isoform
    complexed with zn

Details for d1jk0a_

PDB Entry: 1jk0 (more details), 2.8 Å

PDB Description: Ribonucleotide reductase Y2Y4 heterodimer
PDB Compounds: (A:) ribonucleoside-diphosphate reductase small chain 1

SCOPe Domain Sequences for d1jk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]}
lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasd
givnenlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaih
tipeigekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfs
nelicrdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnad
lmnqyvefvadrllvafgnkkyykvenpfdfmen

SCOPe Domain Coordinates for d1jk0a_:

Click to download the PDB-style file with coordinates for d1jk0a_.
(The format of our PDB-style files is described here.)

Timeline for d1jk0a_: