Lineage for d1jjya_ (1jjy A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87425Fold e.26: Prismane protein-like [56820] (1 superfamily)
  4. 87426Superfamily e.26.1: Prismane protein-like [56821] (2 families) (S)
  5. 87432Family e.26.1.2: Ni-containing carbon monoxide dehydrogenase [64514] (1 protein)
  6. 87433Protein Ni-containing carbon monoxide dehydrogenase [64515] (1 species)
  7. 87434Species Carboxydothermus hydrogenoformans [64516] (1 PDB entry)
  8. 87435Domain d1jjya_: 1jjy A: [63141]

Details for d1jjya_

PDB Entry: 1jjy (more details), 1.63 Å

PDB Description: crystal structure of a ni-containing carbon monoxide dehydrogenase from carboxydothermus hydrogenoformans

SCOP Domain Sequences for d1jjya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjya_ e.26.1.2 (A:) Ni-containing carbon monoxide dehydrogenase {Carboxydothermus hydrogenoformans}
qnlkstdravqqmldkakregiqtvwdryeamkpqcgfgetglccrhclqgpcrinpfgd
epkvgicgataevivargldrsiaagaaghsghakhlahtlkkavqgkaasymikdrtkl
hsiakrlgiptegqkdedialevakaaladfhekdtpvlwvttvlppsrvkvlsahglip
agidheiaeimhrtsmgcdadaqnlllgglrcsladlagcymgtdladilfgtpapvvte
snlgvlkadavnvavhghnpvlsdiivsvskemenearaagatginvvgicctgnevlmr
hgipacthsvsqemamitgaldamildyqciqpsvatiaectgttvittmemskitgath
vnfaeeaavenakqilrlaidtfkrrkgkpveipniktkvvagfsteaiinalsklnand
plkplidnvvngnirgvclfagcnnvkvpqdqnfttiarkllkqnvlvvatgcgagalmr
hgfmdpanvdelcgdglkavltaigeanglggplppvlhmgscvdnsrsvalvaalanrl
gvdmdrlpvvasaaqamhekavaigtwavtiglpthigvfppitgslpvtqiltssvkdi
tggyfiveldpqvaadkllaainerraglglpr

SCOP Domain Coordinates for d1jjya_:

Click to download the PDB-style file with coordinates for d1jjya_.
(The format of our PDB-style files is described here.)

Timeline for d1jjya_: