Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) |
Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (4 PDB entries) |
Domain d1jjhb1: 1jjh B:326-410 [63120] Other proteins in same PDB: d1jjha2, d1jjhb2 |
PDB Entry: 1jjh (more details), 2.5 Å
SCOPe Domain Sequences for d1jjhb1:
Sequence, based on SEQRES records: (download)
>d1jjhb1 d.58.8.1 (B:326-410) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]} scfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgspsq rqdflkhvplppgmnisgftasldf
>d1jjhb1 d.58.8.1 (B:326-410) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]} scfalisgtanqvkcyrfrvkknhrhryenctttwftvaqaqilitfgspsqrqdflkhv plppgmnisgftasldf
Timeline for d1jjhb1: