Lineage for d1jjha1 (1jjh A:326-410)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195834Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2195835Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2195842Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 2195843Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (3 PDB entries)
  8. 2195845Domain d1jjha1: 1jjh A:326-410 [63119]
    Other proteins in same PDB: d1jjha2, d1jjhb2

Details for d1jjha1

PDB Entry: 1jjh (more details), 2.5 Å

PDB Description: e2 dna-binding domain from bovine papillomavirus type 1
PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1jjha1:

Sequence, based on SEQRES records: (download)

>d1jjha1 d.58.8.1 (A:326-410) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
scfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgspsq
rqdflkhvplppgmnisgftasldf

Sequence, based on observed residues (ATOM records): (download)

>d1jjha1 d.58.8.1 (A:326-410) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
scfalisgtanqvkcyrfrvkknhrhryenctttwftvqaqilitfgspsqrqdflkhvp
lppgmnisgftasldf

SCOPe Domain Coordinates for d1jjha1:

Click to download the PDB-style file with coordinates for d1jjha1.
(The format of our PDB-style files is described here.)

Timeline for d1jjha1: