SCOPe 2.01: Domain d1jjea_: 1jje A:

Lineage for d1jjea_ (1jje A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (11 species)

7. Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (5 PDB entries)

8. Domain d1jjea_: 1jje A: [63117]
   complexed with act, bys, zn

Details for d1jjea_

PDB Entry: 1jje, 1.8 Å

PDB Description: imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (11)

PDB Compounds: (A:) imp-1 metallo beta-lactamase

SCOPe Domain Sequences for d1jjea_:

Sequence; same for both SEQRES and ATOM records:

>d1jjea_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglneskk

Timeline for d1jjea_:

• d1jjea_ first appeared in SCOP 1.57
  
• d1jjea_ appears in SCOP 1.75
  
• d1jjea_ appears in SCOPe 2.02
  
• d1jjea_ appears in the current release, SCOPe 2.08