![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
![]() | Protein Peptide transporter Tap1, C-terminal ABC domain [64029] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64030] (1 PDB entry) |
![]() | Domain d1jj7a_: 1jj7 A: [63114] complexed with adp, mg |
PDB Entry: 1jj7 (more details), 2.4 Å
SCOP Domain Sequences for d1jj7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} glltplhleglvqfqdvsfaypnrpdvlvlqgltftlrpgevtalvgpngsgkstvaall qnlyqptggqllldgkplpqyehrylhrqvaavgqepqvfgrslqeniaygltqkptmee itaaavksgahsfisglpqgydtevdeagsqlsggqrqavalaralirkpcvlilddats aldansqlqveqllyesperysrsvllitqhlslveqadhilfleggaireggthqqlme kkgcywamvqa
Timeline for d1jj7a_: