SCOPe 2.07: Domain d1jj4b1: 1jj4 B:287-364

Lineage for d1jj4b1 (1jj4 B:287-364)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 18 [TaxId:333761] [54963] (2 PDB entries)

8. Domain d1jj4b1: 1jj4 B:287-364 [63113]
   Other proteins in same PDB: d1jj4a2, d1jj4b2
   protein/DNA complex

Details for d1jj4b1

PDB Entry: 1jj4, 2.4 Å

PDB Description: human papillomavirus type 18 e2 dna-binding domain bound to its dna target

PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d1jj4b1:

Sequence, based on SEQRES records:

>d1jj4b1 d.58.8.1 (B:287-364) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqrtkf
lntvaipdsvqilvgymt

Sequence, based on observed residues (ATOM records):

>d1jj4b1 d.58.8.1 (B:287-364) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtektgiltvtyhsetqrtkflntv
aipdsvqilvgymt

Timeline for d1jj4b1:

• d1jj4b1 first appeared in SCOP 1.57, called d1jj4b_
  
• d1jj4b1 appears in SCOPe 2.06
  
• d1jj4b1 appears in the current release, SCOPe 2.08