Lineage for d1jj4b1 (1jj4 B:287-364)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195834Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2195835Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2195842Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 2195858Species Human papillomavirus type 18 [TaxId:333761] [54963] (2 PDB entries)
  8. 2195864Domain d1jj4b1: 1jj4 B:287-364 [63113]
    Other proteins in same PDB: d1jj4a2, d1jj4b2
    protein/DNA complex

Details for d1jj4b1

PDB Entry: 1jj4 (more details), 2.4 Å

PDB Description: human papillomavirus type 18 e2 dna-binding domain bound to its dna target
PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d1jj4b1:

Sequence, based on SEQRES records: (download)

>d1jj4b1 d.58.8.1 (B:287-364) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqrtkf
lntvaipdsvqilvgymt

Sequence, based on observed residues (ATOM records): (download)

>d1jj4b1 d.58.8.1 (B:287-364) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtektgiltvtyhsetqrtkflntv
aipdsvqilvgymt

SCOPe Domain Coordinates for d1jj4b1:

Click to download the PDB-style file with coordinates for d1jj4b1.
(The format of our PDB-style files is described here.)

Timeline for d1jj4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jj4b2