Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) |
Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
Species Human papillomavirus type 18 [TaxId:333761] [54963] (2 PDB entries) |
Domain d1jj4b1: 1jj4 B:287-364 [63113] Other proteins in same PDB: d1jj4a2, d1jj4b2 protein/DNA complex |
PDB Entry: 1jj4 (more details), 2.4 Å
SCOPe Domain Sequences for d1jj4b1:
Sequence, based on SEQRES records: (download)
>d1jj4b1 d.58.8.1 (B:287-364) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]} tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqrtkf lntvaipdsvqilvgymt
>d1jj4b1 d.58.8.1 (B:287-364) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]} tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtektgiltvtyhsetqrtkflntv aipdsvqilvgymt
Timeline for d1jj4b1: