Lineage for d1jj2x_ (1jj2 X:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690198Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 690234Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 690235Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 690236Protein Ribosomal protein L32e [52044] (1 species)
  7. 690237Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (40 PDB entries)
  8. 690238Domain d1jj2x_: 1jj2 X: [63109]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2x_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution
PDB Compounds: (X:) ribosomal protein l32e

SCOP Domain Sequences for d1jj2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2x_ c.9.2.1 (X:) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1jj2x_:

Click to download the PDB-style file with coordinates for d1jj2x_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2x_: