| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) ![]() automatically mapped to Pfam PF01198 |
| Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
| Protein Ribosomal protein L31e [54577] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries) Uniprot P18138 |
| Domain d1jj2w_: 1jj2 W: [63108] Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2x_, d1jj2y_, d1jj2z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1jj2 (more details), 2.4 Å
SCOPe Domain Sequences for d1jj2w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj2w_ d.29.1.1 (W:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae
Timeline for d1jj2w_:
View in 3DDomains from other chains: (mouse over for more information) d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2x_, d1jj2y_, d1jj2z_ |