Lineage for d1jj2h_ (1jj2 H:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132648Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 132724Superfamily d.41.4: Ribosomal protein L10e [54686] (1 family) (S)
  5. 132725Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 132726Protein Ribosomal protein L10e [54688] (1 species)
  7. 132727Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (3 PDB entries)
  8. 132728Domain d1jj2h_: 1jj2 H: [63093]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2h_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2h_:

Sequence, based on SEQRES records: (download)

>d1jj2h_ d.41.4.1 (H:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1jj2h_ d.41.4.1 (H:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna

SCOP Domain Coordinates for d1jj2h_:

Click to download the PDB-style file with coordinates for d1jj2h_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2h_: