SCOP 1.57: Domain d1jj2a2: 1jj2 A:1-90

Lineage for d1jj2a2 (1jj2 A:1-90)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (10 proteins)

6. Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)

7. Species Haloarcula marismortui [TaxId:2238] [50301] (2 PDB entries)

8. Domain d1jj2a2: 1jj2 A:1-90 [63085]
   Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2a2

PDB Entry: 1jj2, 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2a2:

Sequence; same for both SEQRES and ATOM records:

>d1jj2a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

Timeline for d1jj2a2:

• d1jj2a2 is new in SCOP 1.57
  
• d1jj2a2 appears in SCOP 1.59
  
• d1jj2a2 appears in the current release, SCOPe 2.08