Lineage for d1jj2a1 (1jj2 A:91-237)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295918Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 295962Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 295963Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 295964Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (12 PDB entries)
  8. 295965Domain d1jj2a1: 1jj2 A:91-237 [63084]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2a1

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2a1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1jj2a1:

Click to download the PDB-style file with coordinates for d1jj2a1.
(The format of our PDB-style files is described here.)

Timeline for d1jj2a1: