SCOP 1.61: Domain d1jiwp2: 1jiw P:1-246

Lineage for d1jiwp2 (1jiw P:1-246)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein)

6. Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species)

7. Species Pseudomonas aeruginosa, alkaline protease [55510] (3 PDB entries)

8. Domain d1jiwp2: 1jiw P:1-246 [63080]
   Other proteins in same PDB: d1jiwi_, d1jiwp1

Details for d1jiwp2

PDB Entry: 1jiw, 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

SCOP Domain Sequences for d1jiwp2:

Sequence; same for both SEQRES and ATOM records:

>d1jiwp2 d.92.1.6 (P:1-246) Metallo protease, catalytic (N-terminal) domain {Pseudomonas aeruginosa, alkaline protease}
grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
aiqkly

Timeline for d1jiwp2:

• d1jiwp2 first appeared in SCOP 1.57
  
• d1jiwp2 appears in SCOP 1.59
  
• d1jiwp2 appears in SCOP 1.63
  
• d1jiwp2 appears in the current release, SCOPe 2.08