Lineage for d1jiwp2 (1jiw P:1-246)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82192Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 82193Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) (S)
  5. 82263Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein)
  6. 82264Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species)
  7. 82265Species Pseudomonas aeruginosa, alkaline protease [55510] (3 PDB entries)
  8. 82267Domain d1jiwp2: 1jiw P:1-246 [63080]
    Other proteins in same PDB: d1jiwi_, d1jiwp1

Details for d1jiwp2

PDB Entry: 1jiw (more details), 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

SCOP Domain Sequences for d1jiwp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiwp2 d.92.1.6 (P:1-246) Metallo protease, catalytic (N-terminal) domain {Pseudomonas aeruginosa, alkaline protease}
grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
aiqkly

SCOP Domain Coordinates for d1jiwp2:

Click to download the PDB-style file with coordinates for d1jiwp2.
(The format of our PDB-style files is described here.)

Timeline for d1jiwp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jiwp1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jiwi_