SCOP 1.63: Domain d1jiwp1: 1jiw P:247-470

Lineage for d1jiwp1 (1jiw P:247-470)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.79: beta-Roll [51119] (1 superfamily)
   contains a parallel beta-helix that binds calcium ions between its turns

4. Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family)
   duplication: halfturs of beta-helix are sequence and structural repeats

5. Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)

6. Protein Metalloprotease [51122] (4 species)
   The catalitic N-terminal domain belong to the "zincin" superfamily

7. Species Pseudomonas aeruginosa [TaxId:287] [51123] (3 PDB entries)
   alkaline protease

8. Domain d1jiwp1: 1jiw P:247-470 [63079]
   Other proteins in same PDB: d1jiwi_, d1jiwp2
   complexed with ca, zn

Details for d1jiwp1

PDB Entry: 1jiw, 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

SCOP Domain Sequences for d1jiwp1:

Sequence; same for both SEQRES and ATOM records:

>d1jiwp1 b.79.1.1 (P:247-470) Metalloprotease {Pseudomonas aeruginosa}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

Timeline for d1jiwp1:

• d1jiwp1 first appeared in SCOP 1.57
  
• d1jiwp1 appears in SCOP 1.61
  
• d1jiwp1 appears in SCOP 1.65
  
• d1jiwp1 appears in the current release, SCOPe 2.08