SCOP 1.61: Domain d1jiwp1: 1jiw P:247-470

Lineage for d1jiwp1 (1jiw P:247-470)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.79: beta-Roll [51119] (1 superfamily)

4. Superfamily b.79.1: Metalloprotease, C-terminal domain [51120] (1 family)

5. Family b.79.1.1: Metalloprotease, C-terminal domain [51121] (1 protein)

6. Protein Metalloprotease, C-terminal domain [51122] (2 species)

7. Species Pseudomonas aeruginosa, alkaline protease [51123] (3 PDB entries)

8. Domain d1jiwp1: 1jiw P:247-470 [63079]
   Other proteins in same PDB: d1jiwi_, d1jiwp2

Details for d1jiwp1

PDB Entry: 1jiw, 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

SCOP Domain Sequences for d1jiwp1:

Sequence; same for both SEQRES and ATOM records:

>d1jiwp1 b.79.1.1 (P:247-470) Metalloprotease, C-terminal domain {Pseudomonas aeruginosa, alkaline protease}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

Timeline for d1jiwp1:

• d1jiwp1 first appeared in SCOP 1.57
  
• d1jiwp1 appears in SCOP 1.59
  
• d1jiwp1 appears in SCOP 1.63
  
• d1jiwp1 appears in the current release, SCOPe 2.08