Lineage for d1jiwp1 (1jiw P:247-470)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63476Fold b.79: beta-Roll [51119] (1 superfamily)
  4. 63477Superfamily b.79.1: Metalloprotease, C-terminal domain [51120] (1 family) (S)
  5. 63478Family b.79.1.1: Metalloprotease, C-terminal domain [51121] (1 protein)
  6. 63479Protein Metalloprotease, C-terminal domain [51122] (2 species)
  7. 63480Species Pseudomonas aeruginosa, alkaline protease [51123] (3 PDB entries)
  8. 63482Domain d1jiwp1: 1jiw P:247-470 [63079]
    Other proteins in same PDB: d1jiwi_, d1jiwp2

Details for d1jiwp1

PDB Entry: 1jiw (more details), 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

SCOP Domain Sequences for d1jiwp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiwp1 b.79.1.1 (P:247-470) Metalloprotease, C-terminal domain {Pseudomonas aeruginosa, alkaline protease}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

SCOP Domain Coordinates for d1jiwp1:

Click to download the PDB-style file with coordinates for d1jiwp1.
(The format of our PDB-style files is described here.)

Timeline for d1jiwp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jiwp2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jiwi_