SCOP 1.63: Domain d1jiwi_: 1jiw I:

Lineage for d1jiwi_ (1jiw I:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.2: Metalloprotease inhibitor [50882] (1 family)

5. Family b.61.2.1: Metalloprotease inhibitor [50883] (1 protein)

6. Protein Metalloprotease inhibitor [50884] (2 species)

7. Species Pseudomonas aeruginosa, aprin [TaxId:287] [63813] (1 PDB entry)

8. Domain d1jiwi_: 1jiw I: [63078]
   Other proteins in same PDB: d1jiwp1, d1jiwp2
   complexed with ca, zn

Details for d1jiwi_

PDB Entry: 1jiw, 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

SCOP Domain Sequences for d1jiwi_:

Sequence; same for both SEQRES and ATOM records:

>d1jiwi_ b.61.2.1 (I:) Metalloprotease inhibitor {Pseudomonas aeruginosa, aprin}
sslillsasdlagqwtlqqdeapaichlelrdsevaeasgydlggdtacltrwlpsepra
wrptpagiallerggltlmllgrqgegdyrvqkgdggqlvlrrat

Timeline for d1jiwi_:

• d1jiwi_ first appeared in SCOP 1.57
  
• d1jiwi_ appears in SCOP 1.61
  
• d1jiwi_ appears in SCOP 1.65
  
• d1jiwi_ appears in the current release, SCOPe 2.08