![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Maltogenic amylase, central domain [51465] (4 species) contains an additional N-terminal domain |
![]() | Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (12 PDB entries) |
![]() | Domain d1jibb3: 1jib B:121-502 [63074] Other proteins in same PDB: d1jiba1, d1jiba2, d1jibb1, d1jibb2 complexed with mtt |
PDB Entry: 1jib (more details), 3.3 Å
SCOPe Domain Sequences for d1jibb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jibb3 c.1.8.1 (B:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn rglfefykelirlrhrlasltr
Timeline for d1jibb3: