| Class b: All beta proteins [48724] (178 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Maltogenic amylase [51031] (4 species) |
| Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries) |
| Domain d1jibb2: 1jib B:503-585 [63073] Other proteins in same PDB: d1jiba1, d1jiba3, d1jibb1, d1jibb3 complexed with mtt |
PDB Entry: 1jib (more details), 3.3 Å
SCOPe Domain Sequences for d1jibb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jibb2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr
Timeline for d1jibb2: